PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30314.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 275aa    MW: 32188 Da    PI: 8.4206
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30314.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll ++v ++G g+W+++a+  g++R++k+c++rw +yl
       KHN30314.1 13 KGPWTGEEDKLLSEYVSLHGDGRWSSVAKFTGLNRSGKSCRLRWVNYL 60
                     79********************************************97 PP

2Myb_DNA-binding49.78.8e-1667110247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g  T+ E+e+++++++ lG++ W+tIa+++  gRt++++k++w+++
       KHN30314.1  67 GQLTPLEEEIIIELHATLGNK-WSTIAKYLS-GRTDNEIKNYWRTH 110
                      677999***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.918864IPR017930Myb domain
SuperFamilySSF466891.39E-3010107IPR009057Homeodomain-like
SMARTSM007176.7E-161262IPR001005SANT/Myb domain
PfamPF002494.0E-171360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-221467IPR009057Homeodomain-like
CDDcd001671.45E-111560No hitNo description
PROSITE profilePS5129418.56165115IPR017930Myb domain
SMARTSM007175.2E-1365113IPR001005SANT/Myb domain
PfamPF002497.8E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2368113IPR009057Homeodomain-like
CDDcd001671.05E-970111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MMGSLATQKG WRKGPWTGEE DKLLSEYVSL HGDGRWSSVA KFTGLNRSGK SCRLRWVNYL  60
RPGLKKGQLT PLEEEIIIEL HATLGNKWST IAKYLSGRTD NEIKNYWRTH FGKRERSKHK  120
KKLQRPKVKR VLKQLKHKQQ QEQQPQEYDI KSIMSHEETV NETKSFETQN CKQQEMGFMY  180
PTTEHQYTVP NSLHEGFSST WQDSTLVDDD SWFSLWDFDE PQGFSDYVDQ FSKCAMPNQA  240
TFRVGGDYSM QNDVKTSRFD DAYDNDLFYG KDMFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251310727120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991000.0BT099100.1 Soybean clone JCVI-FLGm-16H10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240937.10.0uncharacterized protein LOC100785540
TrEMBLA0A0B2RD630.0A0A0B2RD63_GLYSO; Transcription factor MYB59
TrEMBLC6TMY90.0C6TMY9_SOYBN; Uncharacterized protein
STRINGGLYMA08G27660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.18e-54myb domain protein 121
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]